PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008218619.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 466aa    MW: 52736 Da    PI: 6.8799
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008218619.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.81.1e-49451702128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                     +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++
  XP_008218619.1  45 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSEN 138
                     79***************************.89***************888889****************************************** PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +glkktLvfy+g+apkg +t+W+m+eyrl
  XP_008218619.1 139 FRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 170
                     ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.58844191IPR003441NAC domain
SuperFamilySSF1019411.83E-5544190IPR003441NAC domain
PfamPF023651.4E-2446170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MAIAATTTSS SSTMSVNDES NKADHDHDHH HDGDDDDEHE HDMVMPGFRF HPTEEELVEF  60
YLRRKVEGKR FNVELITFLD LYRYDPWELP AMAAIGEKEW FFYVPRDRKY RNGDRPNRVT  120
TSGYWKATGA DRMIRSENFR SIGLKKTLVF YSGKAPKGIR TSWIMNEYRL PHHETERYQK  180
GEISLCRVYK RAGVEDHPSL PRSLPASKAS TSRSSVLVAP STTISSDNKK QHNTSTNINN  240
NNINTVHSIM EKLQAFNEGQ SQQFHQDPEH QVDQKMSVEP EGSSGNSDVT TVLGLSKRNA  300
YHHNNIGQAH HHPLDQEEGM AAFLHHSNSK QAAANCFSLI PSSTNSSATL FTAGSSSVSS  360
SNMNAIDDLH RLLTYQHVQQ QAAAASSHHQ QQHVHHHVVQ YYDDAHHHPQ PNNLFSTFPA  420
AAPHVQSAIP PQQLAPNALP TAFSDRLWDW NPISDPNRPD YNNPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-554619119165NAC domain-containing protein 19
4dul_A8e-554619119165NAC domain-containing protein 19
1ut7_B8e-554619119165NO APICAL MERISTEM PROTEIN
1ut7_A8e-554619119165NO APICAL MERISTEM PROTEIN
1ut4_B8e-554619119165NO APICAL MERISTEM PROTEIN
1ut4_A8e-554619119165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008218619.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A0M5JHG91e-156A0A0M5JHG9_MANES; NAC transcription factors 10
STRINGGLYMA17G00650.21e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-113NAC domain containing protein 35